PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G68120.1
Common NameATBPC3, BPC3, T23K23.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BBR-BPC
Protein Properties Length: 270aa    MW: 30522.9 Da    PI: 9.9211
Description basic pentacysteine 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G68120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind45.43e-142101190
    GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaav.........aerd........maflqrdkalaernkalver 77 
                  m++dg ++rn+gyyep+ +++ nlg+ql+ si +r++k+    +++nl+++++++++         ++rd        m++    ++l++      ++
  AT1G68120.1   2 MEEDGLNNRNWGYYEPS-QFRPNLGFQLIPSILDRNEKPflspHSQNLNFITPSNVYgggsssvvsYPRDytvsdapfMSY----SWLNQ------HK 88 
                  9***************9.***************************************999999888888888888777777....99999......99 PP

    GAGA_bind  78 dnkllalllvens 90 
                  d+k++++++    
  AT1G68120.1  89 DSKFFSNVPEVSR 101
                  9999999886554 PP

2GAGA_bind287.84.7e-88102270126301
    GAGA_bind 126 lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqC 222
                  ++++ +l +++++++++e+ ++++++ +qr+ +pk+kk+kk k+        +++++++ ers   +k+i++v+ngvs+D+++lPvPvCsCtG+++qC
  AT1G68120.1 102 MTQSMQLLQPEVVTEVDESVKRRHCSGGQRGGVPKVKKEKKLKD--------NNMPRVQrERSPLLRKCIEMVINGVSMDIGGLPVPVCSCTGMPQQC 191
                  5566678899*******************************999........344444448899********************************** PP

    GAGA_bind 223 YkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                  Y+WG+GGWqSaCCtt++S+yPLPv+tkrrgaRiagrKmSqgaf+k+LekL+++G+d+snp+DLk+hWAkHGtnkfvtir
  AT1G68120.1 192 YRWGCGGWQSACCTTNVSMYPLPVNTKRRGARIAGRKMSQGAFRKVLEKLSSDGFDFSNPIDLKSHWAKHGTNKFVTIR 270
                  ******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.1E-822270IPR010409GAGA-binding transcriptional activator
SMARTSM012261.2E-1612270IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MMEEDGLNNR NWGYYEPSQF RPNLGFQLIP SILDRNEKPF LSPHSQNLNF ITPSNVYGGG  60
SSSVVSYPRD YTVSDAPFMS YSWLNQHKDS KFFSNVPEVS RMTQSMQLLQ PEVVTEVDES  120
VKRRHCSGGQ RGGVPKVKKE KKLKDNNMPR VQRERSPLLR KCIEMVINGV SMDIGGLPVP  180
VCSCTGMPQQ CYRWGCGGWQ SACCTTNVSM YPLPVNTKRR GARIAGRKMS QGAFRKVLEK  240
LSSDGFDFSN PIDLKSHWAK HGTNKFVTIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.355670.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453372790.0
Genevisible259998_at0.0
Expression AtlasAT1G68120-
AtGenExpressAT1G68120-
ATTED-IIAT1G68120-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in petal vasculature, in anthers, in young rosette, in the lateral and primary roots, and in the gynobasal portion of the ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Function -- GeneRIF ? help Back to Top
  1. The loss of BPC3 activity suppresses both the dwarfism and short primary inflorescence phenotypes.
    [PMID: 21435046]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G68120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G68120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0125630.0AC012563.7 Arabidopsis thaliana chromosome 1 BAC T23K23 genomic sequence, complete sequence.
GenBankBT0221170.0BT022117.1 Arabidopsis thaliana At1g68120 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176979.20.0basic pentacysteine 3
SwissprotQ9C9X60.0BPC3_ARATH; Protein BASIC PENTACYSTEINE3
TrEMBLD7KVR81e-165D7KVR8_ARALL; Putative uncharacterized protein (Fragment)
STRINGAT1G68120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153471518
Representative plantOGRP18651240
Publications ? help Back to Top
  1. Santi L, et al.
    The GA octodinucleotide repeat binding factor BBR participates in the transcriptional regulation of the homeobox gene Bkn3.
    Plant J., 2003. 34(6): p. 813-26
    [PMID:12795701]
  2. Meister RJ, et al.
    Definition and interactions of a positive regulatory element of the Arabidopsis INNER NO OUTER promoter.
    Plant J., 2004. 37(3): p. 426-38
    [PMID:14731261]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Monfared MM, et al.
    Overlapping and antagonistic activities of BASIC PENTACYSTEINE genes affect a range of developmental processes in Arabidopsis.
    Plant J., 2011. 66(6): p. 1020-31
    [PMID:21435046]